PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22749A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 404aa    MW: 43380.5 Da    PI: 5.7729
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22749AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.43.9e-195299148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  Oropetium_20150105_22749A 52 RGQWTPEEDNKLLSYITQYGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 99
                               89********************************************97 PP

2Myb_DNA-binding452.6e-14106148246
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                g +T  E++ +++++   G++ W+ Ia+ ++ gRt++++k++w++
  Oropetium_20150105_22749A 106 GEFTDAEEQTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 148
                                789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-2643102IPR009057Homeodomain-like
PROSITE profilePS5129426.85747103IPR017930Myb domain
SuperFamilySSF466891.12E-2949146IPR009057Homeodomain-like
SMARTSM007173.8E-1451101IPR001005SANT/Myb domain
PfamPF002497.2E-175299IPR001005SANT/Myb domain
CDDcd001678.79E-135599No hitNo description
Gene3DG3DSA:1.10.10.602.4E-24103154IPR009057Homeodomain-like
SMARTSM007172.8E-14104152IPR001005SANT/Myb domain
PROSITE profilePS5129420.197104154IPR017930Myb domain
PfamPF002497.6E-13106148IPR001005SANT/Myb domain
CDDcd001671.64E-10107150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MSRPPHAGRR TCRVAAPELE QGPIEHLGLA GEEGAGREMG RVPCCEKDNV KRGQWTPEED  60
NKLLSYITQY GTRNWRLIPK NAGLQRCGKS CRLRWTNYLR PDLKHGEFTD AEEQTIIKLH  120
SVVGNRWSVI AAQLPGRTDN DVKNHWNTKL KKKLSGMGID PVTHKSFSHL MAEIATTLAP  180
PQVAHLAEAA LGCFKDEMLH LLTKKRPTDF PAPAAVPGIM GVGSAGGGGP AALAARCFPP  240
APPPQADDTV ERIKLGLSRA IMSEQPAADN NNKQHQQQSP WAPADMSDGL AAGMYAAYNP  300
AQGQENDFGY EGVSEYILGG GDADQGTSMW SHQSMYSGSS GTEAPRPEKG NDSVGSSSRG  360
EDEMDDDAKE EAGKGGGGSD ISGLFGSDCV LWDLPDELTN HMV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30521547108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0342380.0BT034238.1 Zea mays full-length cDNA clone ZM_BFc0028K07 mRNA, complete cds.
GenBankBT0394220.0BT039422.1 Zea mays full-length cDNA clone ZM_BFc0012M19 mRNA, complete cds.
GenBankBT0406700.0BT040670.1 Zea mays full-length cDNA clone ZM_BFc0113I05 mRNA, complete cds.
GenBankBT0432400.0BT043240.1 Zea mays full-length cDNA clone ZM_BFc0129J22 mRNA, complete cds.
GenBankBT0549880.0BT054988.1 Zea mays full-length cDNA clone ZM_BFc0168O09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975922.10.0PREDICTED: transcription factor MYB12
SwissprotQ7XQN10.0MYB80_ORYSJ; Transcription factor MYB80
TrEMBLK3YD270.0K3YD27_SETIT; Uncharacterized protein
STRINGSi012130m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108673339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-109myb domain protein 103